PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AC235534.1_FGP007
Common NameZEAMMB73_342343
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 863aa    MW: 92985.3 Da    PI: 6.7388
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AC235534.1_FGP007genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.14.2e-20137192156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++  ++t+ q+e+Le++F++ ++p++++r++L+++lgL+ rqVk+WFqNrR+  k
  AC235534.1_FGP007 137 KKPYNRHTPRQIEQLEAMFKEFHHPDEKQRAQLSRQLGLDPRQVKFWFQNRRTHLK 192
                        688999**********************************************9765 PP

2START156.52.1e-493636042206
                        HHHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHH.HHHHHHCCCGG......... CS
              START   2 laeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv.....dsgealrasgvvdmvla.llveellddke......... 70 
                        la +a++elvk+a  +ep+W            e +n +e+l+ f++  +     + +ea+r+sg+v+ ++   l+e ++d  +         
  AC235534.1_FGP007 363 LAVSAMNELVKMARMNEPLWIPTIpspgspimETLNFKEYLKAFSPCVGvkptgFVSEASRESGIVTIDSSaALMEVFMDEVLlvppcslfl 454
                        7889*****************999999*****************9965599999************99887366666666666********* PP

                        ....CT-TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EE CS
              START  71 ....qWdetla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRael 147
                            +W+  +     ka+++e i +g      gal lm+aelq+lsplvp R+++f+R+++ql +g w++vdvS+d  q  +  +   ++++
  AC235534.1_FGP007 455 llprRWSDIFYcivaKASIVEEILPGvagsrnGALLLMQAELQMLSPLVPiREVTFLRFCKQLAEGAWAVVDVSIDGLQTDQCLATNTKCRR 546
                        ********9999999****************************************************************998899******* PP

                        SSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 148 lpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                        lpSg+++++++ng +kvtwveh+++ ++++h+l+++l++sgla ga +w+atlqrqce+
  AC235534.1_FGP007 547 LPSGCVLQDTPNG-CKVTWVEHAEYPEASVHQLYQPLMRSGLALGAGRWLATLQRQCEC 604
                        *************.*******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.94E-19120192IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.1E-22122188IPR009057Homeodomain-like
PROSITE profilePS5007116.86134194IPR001356Homeobox domain
SMARTSM003893.4E-15136198IPR001356Homeobox domain
CDDcd000864.99E-18137192No hitNo description
PfamPF000462.5E-17137191IPR001356Homeobox domain
PROSITE patternPS000270169192IPR017970Homeobox, conserved site
PROSITE profilePS5084842.589353607IPR002913START domain
SuperFamilySSF559612.04E-24355604No hitNo description
CDDcd088752.31E-98357603No hitNo description
SMARTSM002346.8E-37362604IPR002913START domain
PfamPF018521.1E-39363604IPR002913START domain
SuperFamilySSF559612.2E-16626828No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 863 aa     Download sequence    Send to blast
MANAACVGGS FLGVEKGKPA TVSNLGAPAV LLLVLACLPL VLPSSDPKQG MSFGDLDGGG  60
SAAGLQYPYG AFASSPVLSL TVVDARRRRG GGGNAKDASE AENEGQSMMS GHLDVVLSGG  120
GDGEDGEAAN QRKPKRKKPY NRHTPRQIEQ LEAMFKEFHH PDEKQRAQLS RQLGLDPRQV  180
KFWFQNRRTH LKCLTWLSLL HGPELGKNQL ERQENARLKH ENDKLRVENL SIREAIRDLV  240
CSCCGGPAVL GELSPEEHQL RLENARLRDE LARVCTVTSK FIGKPMSHME LLLAKEPHPM  300
TGSSLELAVA VGVGSSVPSS KMPVSTISEL AGSTSSSTGT VTTPMVTASL PMVSIDKSKF  360
AQLAVSAMNE LVKMARMNEP LWIPTIPSPG SPIMETLNFK EYLKAFSPCV GVKPTGFVSE  420
ASRESGIVTI DSSAALMEVF MDEVLLVPPC SLFLLLPRRW SDIFYCIVAK ASIVEEILPG  480
VAGSRNGALL LMQAELQMLS PLVPIREVTF LRFCKQLAEG AWAVVDVSID GLQTDQCLAT  540
NTKCRRLPSG CVLQDTPNGC KVTWVEHAEY PEASVHQLYQ PLMRSGLALG AGRWLATLQR  600
QCECLAILMS SLAAPEHDSA AVSLEGKWSL LKLARRMMEN FCAGMGASSS REWSMLDGFT  660
GSTGKDVRVM VQNSVDEPGV PPGVVLSVAT AVWLPVTPER LFNFLRDEEL RAEWDILSNG  720
GPMQQVLRIS KGQLDGNSVA LLRADHTDSH LNSILILQET CTDRSGAMVV YTPVDFPAMQ  780
LVLGGGDSKN VALLPSGFVI LPAGSTASGL GHKARGSLLT VAFQILVNSQ PTAKLTVESV  840
DTVYSLISCT IEKIKAALHC DVC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130137QRKPKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.3430.0ear| meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAC235534.1_FG007
Cis-element ? help Back to Top
SourceLink
PlantRegMapAC235534.1_FGP007
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2509840.0AJ250984.1 Zea mays mRNA for OCL2 protein (ocl2 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008663479.10.0PREDICTED: homeobox-leucine zipper protein ROC4
SwissprotQ7Y0V90.0ROC4_ORYSJ; Homeobox-leucine zipper protein ROC4
TrEMBLK7UL130.0K7UL13_MAIZE; Outer cell layer2
STRINGAC235534.1_FGP0070.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein